PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009586849.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 329aa    MW: 36147.2 Da    PI: 9.1059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009586849.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.25e-201459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEdell  +v+++G+++W++I++ ++ gR++k+c++rw + 
   XP_009586849.1 14 KGPWSPEEDELLQSLVEKHGPRNWSLISKSVP-GRSGKSCRLRWCNQ 59
                     79******************************.***********985 PP

2Myb_DNA-binding54.82.2e-1768110347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
   XP_009586849.1  68 AFTSEEDETIIRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 110
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.742964IPR017930Myb domain
SuperFamilySSF466896.36E-3211107IPR009057Homeodomain-like
SMARTSM007176.2E-181362IPR001005SANT/Myb domain
PfamPF002497.5E-201459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-271567IPR009057Homeodomain-like
CDDcd001674.44E-171658No hitNo description
SMARTSM007172.2E-1465113IPR001005SANT/Myb domain
PROSITE profilePS5129421.07866115IPR017930Myb domain
CDDcd001678.81E-1268111No hitNo description
PfamPF002492.6E-1468110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2368114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAANTQRKES DRIKGPWSPE EDELLQSLVE KHGPRNWSLI SKSVPGRSGK SCRLRWCNQL  60
SPQVEHRAFT SEEDETIIRA HAKFGNKWAT IARLLSGRTD NAIKNHWNST LKRKCCSMSE  120
DLSFETPQQP LKRSSSVGPS TNFSSGMNPG SPSGSDLSDS SLSGFPQSLV YRPVPRTGGI  180
FPLPPLVQPI ETAPFIPDPP TSLCLSLPGS GTRETSIQTA QPTQLTQPPQ SPPPPPLALP  240
PVDKPVPPPT AVFMAQLPQT KQSYDFCVPA LPKSGEKQFF TPEFLGVLQD MIRKEVRNYM  300
SGVEHNGLCM QTDAIRNAVV KRIGISKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-41131143104C-Myb DNA-Binding Domain
1msf_C9e-41131143104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0325400.0AB032540.1 Nicotiana tabacum B19 mRNA for Myb-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009586849.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW15e-85MYB44_ARATH; Transcription factor MYB44
TrEMBLQ8H0H00.0Q8H0H0_TOBAC; Myb-like protein
STRINGSolyc04g078420.1.11e-169(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.17e-78myb domain protein 73